Mouse Sprr2b protein
This Mouse Sprr2b protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sprr2bSmall proline-rich protein 2B
UniProt
O70554
Expression Region
1-98aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Mus musculus (Mouse)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2804808-01 48 Tests
Human Solute carrier family 22 member 18 (SLC22A18) ELISA Kit
Sign In for Pricing
View Details MBS2804808-02 96 Tests
Human Solute carrier family 22 member 18 (SLC22A18) ELISA Kit
Sign In for Pricing
View Details MBS2804808-03 5x 96 Tests
Human Solute carrier family 22 member 18 (SLC22A18) ELISA Kit
Sign In for Pricing
View Details MBS2804808-04 10x 96 Tests
Human Solute carrier family 22 member 18 (SLC22A18) ELISA Kit
Sign In for Pricing
View Details 
MBS6454235-01 0.1 mL
ANKS1A (Ankyrin Repeat and SAM Domain-Containing Protein 1A, Odin, ANKS1A, ANKS1, KIAA0229, ODIN) (MaxLight 750)
Sign In for Pricing
View Details MBS6454235-02 5x 0.1 mL
ANKS1A (Ankyrin Repeat and SAM Domain-Containing Protein 1A, Odin, ANKS1A, ANKS1, KIAA0229, ODIN) (MaxLight 750)
Sign In for Pricing
View Details