Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XRCC5 protein

This Human XRCC5 protein spans the amino acid sequence from region 251-455aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

86KDA subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 2ATP-dependent DNA helicase II 80KDA subunitCTC box-binding factor 85KDA subunit , CTC85 , CTCBFDNA repair protein XR, CC5Ku80Ku86Lupus Ku autoantigen protein p86Nuclear factor IVThyroid-lupus autoantigen , TLAAX-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)

UniProt

P13010

Expression Region

251-455aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AK1, ID (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HRI, KIAA1369) (AP) discontinued
E8949-15B-AP 200 µL

EIF2AK1, ID (Eukaryotic Translation Initiation Factor 2 alpha Kinase 1, Heme-regulated Eukaryotic Initiation Factor eIF-2-alpha Kinase, Heme-regulated Inhibitor, Heme-controlled Repressor, HCR, Hemin-sensitive Initiation Factor-2 alpha Kinase, PRO1362, HRI, KIAA1369) (AP) discontinued

Sign In for Pricing
View Details
Olfr1176 3'UTR Lenti-reporter-Luc Vector
32641084 1.0 µg

Olfr1176 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C20ORF141 antibody
MBS839458-01 0.1 mL

C20ORF141 antibody

Sign In for Pricing
View Details
C20ORF141 antibody
MBS839458-02 5x 0.1 mL

C20ORF141 antibody

Sign In for Pricing
View Details
Lentiviral human RGPD4 shRNA (UAS) - Lentiviral human RGPD4 shRNA (UAS, GFP) plasmid
GTR15100762 1 Vial

Lentiviral human RGPD4 shRNA (UAS) - Lentiviral human RGPD4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
anti-STARD4
YF-PA22242 50 ul

anti-STARD4

Sign In for Pricing
View Details