Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE4 protein

This Human RNASE4 protein spans the amino acid sequence from region 29-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNS4

UniProt

P34096

Expression Region

29-147aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL7 Protein Vector (Human) (pPB-C-His)
PV078013 500 ng

FBXL7 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Lactobacillus plantarum Formate--tetrahydrofolate ligase (fhs), partial
MBS1360775 Inquire

Recombinant Lactobacillus plantarum Formate--tetrahydrofolate ligase (fhs), partial

Sign In for Pricing
View Details
Anti-Hsp70 1A (2D4) Mouse Monoclonal Antibody
MA3131-.1 100 µL

Anti-Hsp70 1A (2D4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-p63 (Ser455) Rabbit Polyclonal Antibody (BF405)
orb2427649 100 µL

Phospho-p63 (Ser455) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Simport, CytoSep Metal Cytology
1218158 6 PK

Simport, CytoSep Metal Cytology

Sign In for Pricing
View Details
Eukaryotic translation initiation Factor 5 (EIF5) Rat ELISA Kit
D2858 96 Tests

Eukaryotic translation initiation Factor 5 (EIF5) Rat ELISA Kit

Sign In for Pricing
View Details