Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria fno protein

This Bacteria fno protein spans the amino acid sequence from region 1-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F420H2, NADP oxidoreductase

UniProt

D9PVP5

Expression Region

1-224aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTF Rabbit Polyclonal Antibody
TA368670 100 µL

CNTF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
16S V5-V7 Library Preparation Kit for Illumina (Set A)
70810 96 Preparations

16S V5-V7 Library Preparation Kit for Illumina (Set A)

Sign In for Pricing
View Details
CNTF Human Gene Knockout Kit (CRISPR)
KN422331 1 Kit

CNTF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM214 antibody
FNab08772 100 µg

TMEM214 antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-,  15nm
GP-5901-15 1 mL

Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-, 15nm

Sign In for Pricing
View Details
(5Z)-rel-Cloprostenol Sodium
TRC-C587325-2.5MG 2.5 mg

(5Z)-rel-Cloprostenol Sodium

Sign In for Pricing
View Details