Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1QA protein

This Human C1QA protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qa, C1QA_HUMAN, Complement C1q subcomponent subunit A, Complement component 1 q subcomponent A chain, Complement component 1 q subcomponent alpha polypeptide, Complement component C1q A chain

UniProt

P02745

Expression Region

23-245aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cobitolimod (sodium)
HY-160040A 1 Each

Cobitolimod (sodium)

Sign In for Pricing
View Details
Monkey MCT (MCT) ELISA Kit
EMk27589 96 Tests

Monkey MCT (MCT) ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 2, IL-2 ELISA Kit
MBS1608378-01 48 Well

Sheep Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 2, IL-2 ELISA Kit
MBS1608378-02 96 Well

Sheep Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 2, IL-2 ELISA Kit
MBS1608378-03 5x 96 Well

Sheep Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 2, IL-2 ELISA Kit
MBS1608378-04 10x 96 Well

Sheep Interleukin 2, IL-2 ELISA Kit

Sign In for Pricing
View Details