Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria fno protein

This Bacteria fno protein spans the amino acid sequence from region 1-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F420H2, NADP oxidoreductase

UniProt

D9PVP5

Expression Region

1-224aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKM2 (PKM) (NM_002654) Human Over-expression Lysate
LC419188 20 µg

PKM2 (PKM) (NM_002654) Human Over-expression Lysate

Sign In for Pricing
View Details
SLUG (SNAI2) Human Gene Knockout Kit (CRISPR)
KN402365 1 Kit

SLUG (SNAI2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS641393 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706314 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse IgG2a (C1.18.4) Isotype Control for In Vivo - Low Endotoxin
ICH2245-100mg 100 mg

Mouse IgG2a (C1.18.4) Isotype Control for In Vivo - Low Endotoxin

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500525 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details