Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RHD protein

This Human RHD protein spans the amino acid sequence from region 388-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RHXIII Rh polypeptide 2 Short name, RhPII Rhesus D antigen CD_antigen, CD240D

UniProt

Q02161

Expression Region

388-417aa

Tag

N-terminal GST-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ACE-2 Antibody [CoraFluor 1]
NBP1-76611CL1 0.1 mL

Rabbit Polyclonal ACE-2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
OAZ1 Antibody
A33629-50UG 50 µg

OAZ1 Antibody

Sign In for Pricing
View Details
KIAA1958 Peptide
orb2013826 100 µg

KIAA1958 Peptide

Sign In for Pricing
View Details
Gmds sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7463605 3x 1.0 µg

Gmds sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CEP290 sgRNA CRISPR Lentivector (Human) (Target 1)
K0435202 1.0 µg DNA

CEP290 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PDZ And LIM Domain Protein 1 (PDLIM1) BioAssayTM ELISA Kit (Human)
152929 96 Tests

PDZ And LIM Domain Protein 1 (PDLIM1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details