Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSO protein

This Human CTSO protein spans the amino acid sequence from region 108-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSO1

UniProt

P43234

Expression Region

108-321aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TMEM106B Antibody [DyLight 350]
NBP2-82027UV 0.1 mL

Rabbit Polyclonal TMEM106B Antibody [DyLight 350]

Sign In for Pricing
View Details
Rabbit anti Human Lass2
X2309P 100 µg

Rabbit anti Human Lass2

Sign In for Pricing
View Details
Rabbit Polyclonal FUS Antibody [Janelia Fluor 549]
NB100-561JF549 0.1 mL

Rabbit Polyclonal FUS Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
9330182L06Rik (NM_172706) Mouse Tagged ORF Clone Lentiviral Particle
MR214210L4V 200 µL

9330182L06Rik (NM_172706) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KLHL14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25778061 1.0 µg DNA

KLHL14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Brain Tissue Lysate (Normal)
orb1672673 0.1 mg

Brain Tissue Lysate (Normal)

Sign In for Pricing
View Details