Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSO protein

This Human CTSO protein spans the amino acid sequence from region 108-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSO1

UniProt

P43234

Expression Region

108-321aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIRE2 Antibody
CSB-PA022589GA01HU 100 µL

SPIRE2 Antibody

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO
VG9F315-01 1 mg

Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO
VG9F315-02 100 µg

Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO
VG9F315-03 20 µg

Recombinant Klebsiella pneumoniae Outer Membrane Porin PhoE (phoE), N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human CXADR/CAR Protein (His & Fc Tag)
PKSH031425 100 µg

Recombinant Human CXADR/CAR Protein (His & Fc Tag)

Sign In for Pricing
View Details
Rat Plxnb2 Pre-designed siRNA Set A
SI210715A 1 Each

Rat Plxnb2 Pre-designed siRNA Set A

Sign In for Pricing
View Details