Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Odorant-binding protein protein

This Virus Odorant-binding protein protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P27

UniProt

P0C6L6

Expression Region

1-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(D-Phe2) -VIP (human, mouse, rat)
FP109564-01 2000 µg

(D-Phe2) -VIP (human, mouse, rat)

Sign In for Pricing
View Details
(D-Phe2) -VIP (human, mouse, rat)
FP109564-02 5000 μg

(D-Phe2) -VIP (human, mouse, rat)

Sign In for Pricing
View Details
(D-Phe2) -VIP (human, mouse, rat)
FP109564-03 10000 μg

(D-Phe2) -VIP (human, mouse, rat)

Sign In for Pricing
View Details
BPIL2 Rabbit Polyclonal Antibody
orb2142-01 50 μL

BPIL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPIL2 Rabbit Polyclonal Antibody
orb2142-02 100 µL

BPIL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPIL2 Rabbit Polyclonal Antibody
orb2142-03 200 µL

BPIL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details