Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Odorant-binding protein protein

This Virus Odorant-binding protein protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P27

UniProt

P0C6L6

Expression Region

1-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued
223502-01 50 µL

Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued

Sign In for Pricing
View Details
Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued
223502-02 100 µL

Ikaros (DNA-Binding Protein Ikaros, Ikaros Family zinc Finger Protein 1, Lymphoid Transcription Factor LyF-1, IKZF1, IK1, IKAROS, LYF1, ZNFN1A1) discontinued

Sign In for Pricing
View Details
Anterior Gradient 2 Rabbit Polyclonal Antibody
orb5383-01 50 μL

Anterior Gradient 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anterior Gradient 2 Rabbit Polyclonal Antibody
orb5383-02 100 µL

Anterior Gradient 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anterior Gradient 2 Rabbit Polyclonal Antibody
orb5383-03 200 µL

Anterior Gradient 2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
hsa-miR-455-5p miRNA Antagomir
MBS8316259-01 10 nmol

hsa-miR-455-5p miRNA Antagomir

Sign In for Pricing
View Details