Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSO protein

This Human CTSO protein spans the amino acid sequence from region 108-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSO1

UniProt

P43234

Expression Region

108-321aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALLC (Allantoate Amidinohydrolase, Probable Allantoicase) (APC)
123242-APC 100 µL

ALLC (Allantoate Amidinohydrolase, Probable Allantoicase) (APC)

Sign In for Pricing
View Details
Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s
OC163579-01 5 g

Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s

Sign In for Pricing
View Details
Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s
OC163579-02 10 g

Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s

Sign In for Pricing
View Details
Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s
OC163579-03 25 g

Carboxymethyl cellulose sodium - Viscosity 300-600 mPa·s

Sign In for Pricing
View Details
3- (Pyrrolidin-2-ylformamido) propanoic acid hydrochloride
LIC70645-01 50 mg

3- (Pyrrolidin-2-ylformamido) propanoic acid hydrochloride

Sign In for Pricing
View Details
3- (Pyrrolidin-2-ylformamido) propanoic acid hydrochloride
LIC70645-02 0.5 g

3- (Pyrrolidin-2-ylformamido) propanoic acid hydrochloride

Sign In for Pricing
View Details