Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Odorant-binding protein protein

This Bovine Odorant-binding protein protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory mucosa pyrazine-binding protein

UniProt

P07435

Expression Region

1-159aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Bos taurus (Bovine)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem38b Rat shRNA Lentiviral Particle (Locus ID 362521)
TL702311V 500 µL Each

Tmem38b Rat shRNA Lentiviral Particle (Locus ID 362521)

Sign In for Pricing
View Details
Human CACNA1I Protein Lysate
MBS138562-01 0.02 mg

Human CACNA1I Protein Lysate

Sign In for Pricing
View Details
Human CACNA1I Protein Lysate
MBS138562-02 5x 0.02 mg

Human CACNA1I Protein Lysate

Sign In for Pricing
View Details
Recombinant Human NPY1R Protein, N-GST & C-His
E55P8459 50 µg

Recombinant Human NPY1R Protein, N-GST & C-His

Sign In for Pricing
View Details
Hsa-miR-378a-5p inhibitor
HY-RI00844-01 5 nmol

Hsa-miR-378a-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-378a-5p inhibitor
HY-RI00844-02 20 nmol

Hsa-miR-378a-5p inhibitor

Sign In for Pricing
View Details