Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Odorant-binding protein protein

This Virus Odorant-binding protein protein spans the amino acid sequence from region 228-781aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coat protein VP1

UniProt

P07299

Expression Region

228-781aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Human parvovirus B19 (isolate AU) (HPV B19)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSVNSAEASTGAGGGGSNSVKSMWSEGATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTISPIMGYSTPWRYLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTISEIAVKDVTDKTGGGVQVTDSTTGRLCMLVDHEYKYPYVLGQGQDTLAPELPIWVYFPPQYAYLTVGDVNTQGISGDSKKLASEESAFYVLEHSSFQLLGTGGTASMSYKFPPVPPENLEGCSQHFYEMYNPLYGSRLGVPDTLGGDPKFRSLTHEDHAIQPQNFMPGPLVNSVSTKEGDSSNTGAGKALTGLSTGTSQNTRISLRPGPVSQPYHHWDTDKYVTGINAISHGQTTYGNAEDKEYQQGVGRFPNEKEQLKQLQGLNMHTYFPNKGTQQYTDQIERPLMVGSVWNRRALHYESQLWSKIPNLDDSFKTQFAALGGWGLHQPPPQIFLKILPQSGPIGGIKSMGITTLVQYAVGIMTVTMTFKLGPRKATGRWNPQPGVYPPHAAGHLPYVLYDPTATDAKQHHRHGYEKPEELWTAKSRVHPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCGF6 (Polycomb group RING finger protein 6) ELISA Kit
EH1378 96 Tests

Human PCGF6 (Polycomb group RING finger protein 6) ELISA Kit

Sign In for Pricing
View Details
Huntington PCR Component C; 65 uL
40-2025-35 65 µL

Huntington PCR Component C; 65 uL

Sign In for Pricing
View Details
Rabbit Polyclonal ACBD6 Antibody [DyLight 650]
NBP2-99708C 0.1 mL

Rabbit Polyclonal ACBD6 Antibody [DyLight 650]

Sign In for Pricing
View Details
FITC anti-human CD127 (IL-7Rα)
E16FHF127-100 100 Tests

FITC anti-human CD127 (IL-7Rα)

Sign In for Pricing
View Details
Deadc1 Protein Vector (Rat) (pPB-N-His)
PV263599 500 ng

Deadc1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rpmD Protein (aa 1-59)
VAng-0130Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei rpmD Protein (aa 1-59)

Sign In for Pricing
View Details