Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 Short name, NKAT-7 NKAT7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA III discontinued
342175-01 100 µL

CA III discontinued

Sign In for Pricing
View Details
CA III discontinued
342175-02 200 µL

CA III discontinued

Sign In for Pricing
View Details
AMPSO Buffer 0.2M, pH 8.0
40120033-4 1 L

AMPSO Buffer 0.2M, pH 8.0

Sign In for Pricing
View Details
ZNF197 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
51343111 3x 1.0 µg

ZNF197 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CXCR2 (IL8RB, C-X-C Chemokine Receptor Type 2, CXC-R2, CXCR-2, CDw128b, GRO/MGSA Receptor, IL-8R B, IL-8 Receptor Type 2, CD182) (PE) discontinued
029514-PE 100 µL

CXCR2 (IL8RB, C-X-C Chemokine Receptor Type 2, CXC-R2, CXCR-2, CDw128b, GRO/MGSA Receptor, IL-8R B, IL-8 Receptor Type 2, CD182) (PE) discontinued

Sign In for Pricing
View Details
CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: 10/78]
SM293PS 100 µg

CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: 10/78]

Sign In for Pricing
View Details