Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 Short name, NKAT-7 NKAT7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl α-D-erythrofuranoside
GC6185-50mg 50 mg

Benzyl α-D-erythrofuranoside

Sign In for Pricing
View Details
PVDF Membrane (0.45 μm)
E801-01 27.5 cm x 3.75 m

PVDF Membrane (0.45 μm)

Sign In for Pricing
View Details
RAMP3 Rabbit Polyclonal Antibody
E28PN2988 100 µL

RAMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2'- O- (6- [Tetramethylrhodaminyl]aminohexylcarbamoyl) guanosine- 3', 5'- cyclic monophosphate (2'-TAMRA-AHC-cGMP), sodium salt
T 017-005 0.5 µmol (~ 461 µg)

2'- O- (6- [Tetramethylrhodaminyl]aminohexylcarbamoyl) guanosine- 3', 5'- cyclic monophosphate (2'-TAMRA-AHC-cGMP), sodium salt

Sign In for Pricing
View Details
N-Cyano-1-chloroformamidine
007165 250 mg

N-Cyano-1-chloroformamidine

Sign In for Pricing
View Details
RCBTB2 Antibody
CSB-PA019504LA01HU-01 50 µg

RCBTB2 Antibody

Sign In for Pricing
View Details