Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 Short name, NKAT-7 NKAT7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66e / CEA Antibody
abx139357 0.1 mg

CD66e / CEA Antibody

Sign In for Pricing
View Details
Olfr470 Lentiviral Activation Particles (m)
sc-434567-LAC 200 µL

Olfr470 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human Proprotein Convertase 9/PCSK9 Affinity Purified PAb
AF3888-SP 25 µg

Human Proprotein Convertase 9/PCSK9 Affinity Purified PAb

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)
MBS1178292-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)
MBS1178292-02 0.02 mg (Yeast)

Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)
MBS1178292-03 0.1 mg (E-Coli)

Recombinant Salmonella heidelberg Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)

Sign In for Pricing
View Details