Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMAD3 protein

This Human SMAD3 protein spans the amino acid sequence from region 1-425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

JV15-2SMAD family member 3 , SMAD 3 , Smad3 , hSMAD3

UniProt

P84022

Expression Region

1-425aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSGLCAT (CHPF2) (NM_001284295) Human Tagged ORF Clone
RC239515 10 µg

CSGLCAT (CHPF2) (NM_001284295) Human Tagged ORF Clone

Sign In for Pricing
View Details
ATG5/APG5L mouse Monoclonal Antibody PE Conjugated
orb1539562 100 µL

ATG5/APG5L mouse Monoclonal Antibody PE Conjugated

Sign In for Pricing
View Details
Anti-TrpV3 Cation Channel Antibody
11527 1 Each

Anti-TrpV3 Cation Channel Antibody

Sign In for Pricing
View Details
Olfactory receptor 2AT4 Polyclonal Antibody
ABP54822-01 30 µL

Olfactory receptor 2AT4 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 2AT4 Polyclonal Antibody
ABP54822-02 100 µL

Olfactory receptor 2AT4 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 2AT4 Polyclonal Antibody
ABP54822-03 200 µL

Olfactory receptor 2AT4 Polyclonal Antibody

Sign In for Pricing
View Details