Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FOLR2 protein

This Human FOLR2 protein spans the amino acid sequence from region 19-230aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein

UniProt

P14207

Expression Region

19-230aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Stau2 Pre-designed siRNA Set A
SI113943A 1 Each

Mouse Stau2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)
MBS256679-01 0.6 mL

8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)

Sign In for Pricing
View Details
8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)
MBS256679-02 2.5 mL

8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)

Sign In for Pricing
View Details
8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)
MBS256679-03 6 mL

8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)

Sign In for Pricing
View Details
8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)
MBS256679-04 5x 6 mL

8-(2-Aminoethylthio)-cyclic diadenosine monophosphate, immobilized on agarose gel (8-AET-c-diAMP-Agarose)

Sign In for Pricing
View Details
PTPN6 (SHP1), Active
MBS517403-01 0.01 mg

PTPN6 (SHP1), Active

Sign In for Pricing
View Details