Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tlr7 protein

This Mouse Tlr7 protein spans the amino acid sequence from region 27-348aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tlr7, Toll-like receptor 7

UniProt

P58681

Expression Region

27-348aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nlk Antibody
orb1268677 400 μl

Nlk Antibody

Sign In for Pricing
View Details
E2F4 Rabbit Polyclonal Antibody (Carrier-free)
orb3079520 100 µg

E2F4 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
PHKB Antibody
A64766-50UL 50 μL

PHKB Antibody

Sign In for Pricing
View Details
Rabbit Anti PGK1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul
IRBAMLPGK1AP734120UL 120 µL

Rabbit Anti PGK1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul

Sign In for Pricing
View Details
AACS (Acetoacetyl-CoA Synthetase, Acyl-CoA Synthetase Family Member 1, Protein Sur-5 Homolog, ACSF1, FLJ12389, FLJ41251) (Biotin)
MBS6368353-01 0.1 mL

AACS (Acetoacetyl-CoA Synthetase, Acyl-CoA Synthetase Family Member 1, Protein Sur-5 Homolog, ACSF1, FLJ12389, FLJ41251) (Biotin)

Sign In for Pricing
View Details
AACS (Acetoacetyl-CoA Synthetase, Acyl-CoA Synthetase Family Member 1, Protein Sur-5 Homolog, ACSF1, FLJ12389, FLJ41251) (Biotin)
MBS6368353-02 5x 0.1 mL

AACS (Acetoacetyl-CoA Synthetase, Acyl-CoA Synthetase Family Member 1, Protein Sur-5 Homolog, ACSF1, FLJ12389, FLJ41251) (Biotin)

Sign In for Pricing
View Details