Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tlr7 protein

This Mouse Tlr7 protein spans the amino acid sequence from region 27-348aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tlr7, Toll-like receptor 7

UniProt

P58681

Expression Region

27-348aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rage siRNA Oligos set (Rat)
38451176 3x 5 nmol

Rage siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Hydrocortisone 21-Valerate
TRC-H714735-10MG 10 mg

Hydrocortisone 21-Valerate

Sign In for Pricing
View Details
ARC Peptide - C-terminal region
MBS3226948-01 0.1 mg

ARC Peptide - C-terminal region

Sign In for Pricing
View Details
ARC Peptide - C-terminal region
MBS3226948-02 5x 0.1 mg

ARC Peptide - C-terminal region

Sign In for Pricing
View Details
Creb3l1 (NM_011957) Mouse Tagged Lenti ORF Clone
MR208154L4 10 µg

Creb3l1 (NM_011957) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Calretinin (CALB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]
TA804244BM 100 µL

Calretinin (CALB2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details