Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mb protein

This Mouse Mb protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mb, Myoglobin

UniProt

P04247

Expression Region

2-154aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2’-Deoxymugineic Acid
008128 250 µg

2’-Deoxymugineic Acid

Sign In for Pricing
View Details
Rat Hydroxy-Pyridinium crosslinks ELISA Kit
MBS727634-01 48 Well

Rat Hydroxy-Pyridinium crosslinks ELISA Kit

Sign In for Pricing
View Details
Rat Hydroxy-Pyridinium crosslinks ELISA Kit
MBS727634-02 96 Well

Rat Hydroxy-Pyridinium crosslinks ELISA Kit

Sign In for Pricing
View Details
Rat Hydroxy-Pyridinium crosslinks ELISA Kit
MBS727634-03 5x 96 Well

Rat Hydroxy-Pyridinium crosslinks ELISA Kit

Sign In for Pricing
View Details
Rat Hydroxy-Pyridinium crosslinks ELISA Kit
MBS727634-04 10x 96 Well

Rat Hydroxy-Pyridinium crosslinks ELISA Kit

Sign In for Pricing
View Details
DUSP1 Antibody
MBS2526319-01 0.06 mL

DUSP1 Antibody

Sign In for Pricing
View Details