Human Versican protein
This Human Versican protein spans the amino acid sequence from region 3089-3354aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Chondroitin sulfate proteoglycan core protein 2
UniProt
P13611
Expression Region
3089-3354aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Elab Fluor® 594 Anti-Mouse CD146 Antibody[ME-9F1]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1c21/imageurl/e-ab-f1395p.webp)
E-AB-F1395P-01 50 Tests
PE/Elab Fluor® 594 Anti-Mouse CD146 Antibody[ME-9F1]
Sign In for Pricing
View Details E-AB-F1395P-02 100 Tests
PE/Elab Fluor® 594 Anti-Mouse CD146 Antibody[ME-9F1]
Sign In for Pricing
View Details E-AB-F1395P-03 2x 100 Tests
PE/Elab Fluor® 594 Anti-Mouse CD146 Antibody[ME-9F1]
Sign In for Pricing
View Details 
BNC470872-500 1x 500 µL
Retinol Binding Protein-1 (RBP/872), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-R0087-01 5x 96 Tests
Uncoated Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
Sign In for Pricing
View Details