Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Versican protein

This Human Versican protein spans the amino acid sequence from region 3089-3354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan core protein 2

UniProt

P13611

Expression Region

3089-3354aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MMP-9/CLG4B protein (His tag)
PDEH100936-01 20 µg

Recombinant Human MMP-9/CLG4B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MMP-9/CLG4B protein (His tag)
PDEH100936-02 100 µg

Recombinant Human MMP-9/CLG4B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MMP-9/CLG4B protein (His tag)
PDEH100936-03 500 µg

Recombinant Human MMP-9/CLG4B protein (His tag)

Sign In for Pricing
View Details
Recombinant Human MMP-9/CLG4B protein (His tag)
PDEH100936-04 1 mg

Recombinant Human MMP-9/CLG4B protein (His tag)

Sign In for Pricing
View Details
Uncoated Monkey CTSS (Cathepsin S) ELISA Kit
E-UNEL-MK0016-01 5x 96 Tests

Uncoated Monkey CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details
Uncoated Monkey CTSS (Cathepsin S) ELISA Kit
E-UNEL-MK0016-02 15x 96 Tests

Uncoated Monkey CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details