What is the catalog number for Virus A Outer capsid glycoprotein VP7 protein?

The catalog number for Virus A Outer capsid glycoprotein VP7 protein is orb595075.

What sizes are available for Virus A Outer capsid glycoprotein VP7 protein?

Virus A Outer capsid glycoprotein VP7 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus A Outer capsid glycoprotein VP7 protein come in?

Virus A Outer capsid glycoprotein VP7 protein is available in 3 different pack sizes.

Is Virus A Outer capsid glycoprotein VP7 protein in stock?

Virus A Outer capsid glycoprotein VP7 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus A Outer capsid glycoprotein VP7 protein

This Virus A Outer capsid glycoprotein VP7 protein spans the amino acid sequence from region 34-309aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer capsid glycoprotein VP7, Fragment

UniProt

A8D8S8

Expression Region

34-309aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV