Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPB protein

This Human SFTPB protein spans the amino acid sequence from region 201-279aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL (Phe)

UniProt

P07988

Expression Region

201-279aa

Tag

N-terminal MBP-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIF Polyclonal Antibody
A70806-100 100 µL

MIF Polyclonal Antibody

Sign In for Pricing
View Details
RSRC1 CRISPR/Cas9 KO Plasmid (h)
sc-412182 20 µg

RSRC1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
TMEM235 Human shRNA Plasmid Kit (Locus ID 283999)
TR321404 1 Kit

TMEM235 Human shRNA Plasmid Kit (Locus ID 283999)

Sign In for Pricing
View Details
PSMA2 Antibody, HRP conjugated
CSB-PA018866LB01HU-01 50 µg

PSMA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSMA2 Antibody, HRP conjugated
CSB-PA018866LB01HU-02 100 µg

PSMA2 Antibody, HRP conjugated

Sign In for Pricing
View Details
HCMV pp65 Rabbit pAb, Pacific Blue conjugated
orb2880307 100 µL

HCMV pp65 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details