What is the catalog number for Human NPHS1 protein?

The catalog number for Human NPHS1 protein is orb605238.

What sizes are available for Human NPHS1 protein?

Human NPHS1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human NPHS1 protein come in?

Human NPHS1 protein is available in 3 different pack sizes.

Is Human NPHS1 protein in stock?

Human NPHS1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human NPHS1 protein

This Human NPHS1 protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Renal glomerulus-specific cell adhesion receptor

UniProt

O60500

Expression Region

23-257aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA