Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cr2 protein

This Mouse Cr2 protein spans the amino acid sequence from region 12-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement C3d receptor CD_antigen, CD21

UniProt

P19070

Expression Region

12-145aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK4-IN-6
BA6062-10 10 mg

IRAK4-IN-6

Sign In for Pricing
View Details
Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody
MBS2544455-01 0.06 mL

Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody
MBS2544455-02 0.12 mL

Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody
MBS2544455-03 0.2 mL

Rabbit anti Mouse LY86/MD-1  Monoclonal Antibody

Sign In for Pricing
View Details
SASS6 Rabbit Polyclonal Antibody (Fluoro550)
orb3103052 100 µg

SASS6 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
PPARA Polyclonal Antibody
MBS2556271-01 0.06 mL

PPARA Polyclonal Antibody

Sign In for Pricing
View Details