Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Outer capsid glycoprotein VP7 protein

This Virus A Outer capsid glycoprotein VP7 protein spans the amino acid sequence from region 192-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into, Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68) ]

UniProt

P26664

Expression Region

192-325aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Hepatitis C virus genotype 1a (isolate 1) (HCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTI 277 HCl
S7465-5mg 5 mg

FTI 277 HCl

Sign In for Pricing
View Details
Phospho-MAPT (S404) Antibody
A11089-100UG 100 µg

Phospho-MAPT (S404) Antibody

Sign In for Pricing
View Details
Neuropeptide VF (NPVF, C7orf9, FMRFamide-related Peptides, RFRP) (FITC)
MBS6000918-01 0.1 mL

Neuropeptide VF (NPVF, C7orf9, FMRFamide-related Peptides, RFRP) (FITC)

Sign In for Pricing
View Details
Neuropeptide VF (NPVF, C7orf9, FMRFamide-related Peptides, RFRP) (FITC)
MBS6000918-02 5x 0.1 mL

Neuropeptide VF (NPVF, C7orf9, FMRFamide-related Peptides, RFRP) (FITC)

Sign In for Pricing
View Details
PRDM1 Rabbit Polyclonal Antibody (FITC)
orb2066139 100 µL

PRDM1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rhot1 (NM_001163355) Mouse Tagged ORF Clone Lentiviral Particle
MR224933L4V 200 µL

Rhot1 (NM_001163355) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details