Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Outer capsid glycoprotein VP7 protein

This Virus A Outer capsid glycoprotein VP7 protein spans the amino acid sequence from region 192-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into, Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68) ]

UniProt

P26664

Expression Region

192-325aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Hepatitis C virus genotype 1a (isolate 1) (HCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Carbohydrate Antigen 72-4 (CA72-4) ELISA Kit
EIA05415m 1 Kit

Mouse Carbohydrate Antigen 72-4 (CA72-4) ELISA Kit

Sign In for Pricing
View Details
Olsalazine sodium impurity I
IO63802-01 10 mg

Olsalazine sodium impurity I

Sign In for Pricing
View Details
Olsalazine sodium impurity I
IO63802-02 25 mg

Olsalazine sodium impurity I

Sign In for Pricing
View Details
Olsalazine sodium impurity I
IO63802-03 50 mg

Olsalazine sodium impurity I

Sign In for Pricing
View Details
Chicken Keratin, type I cytoskeletal 19 ELISA Kit
MBS2883021-01 48 Well

Chicken Keratin, type I cytoskeletal 19 ELISA Kit

Sign In for Pricing
View Details
Chicken Keratin, type I cytoskeletal 19 ELISA Kit
MBS2883021-02 96 Well

Chicken Keratin, type I cytoskeletal 19 ELISA Kit

Sign In for Pricing
View Details