Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP1CC protein

This Human PPP1CC protein spans the amino acid sequence from region 2-323aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rotein phosphatase 1C catalytic subunit (PP-1G)

UniProt

P36873

Expression Region

2-323aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6 delta Blocking Peptide
MBS9631634-01 1 mg

PDE6 delta Blocking Peptide

Sign In for Pricing
View Details
PDE6 delta Blocking Peptide
MBS9631634-02 5x 1 mg

PDE6 delta Blocking Peptide

Sign In for Pricing
View Details
NDUFS3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
31663156 3x 1.0 µg DNA

NDUFS3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human METTL3 (NM_019852) AAV Particle
RC200869A1V 250 µL

Human METTL3 (NM_019852) AAV Particle

Sign In for Pricing
View Details
NEU1 (Sialidase-1, Acetylneuraminyl Hydrolase, G9 sialidase, Lysosomal sialidase, N-acetyl-alpha-neuraminidase 1, NEU1, NANH) discontinued
224458-01 50 µL

NEU1 (Sialidase-1, Acetylneuraminyl Hydrolase, G9 sialidase, Lysosomal sialidase, N-acetyl-alpha-neuraminidase 1, NEU1, NANH) discontinued

Sign In for Pricing
View Details
NEU1 (Sialidase-1, Acetylneuraminyl Hydrolase, G9 sialidase, Lysosomal sialidase, N-acetyl-alpha-neuraminidase 1, NEU1, NANH) discontinued
224458-02 100 µL

NEU1 (Sialidase-1, Acetylneuraminyl Hydrolase, G9 sialidase, Lysosomal sialidase, N-acetyl-alpha-neuraminidase 1, NEU1, NANH) discontinued

Sign In for Pricing
View Details