Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tafa1 protein

This Mouse Tafa1 protein spans the amino acid sequence from region 20-133aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fam19a1

UniProt

Q7TPG8

Expression Region

20-133aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Monkey S100A13 ELISA Kit
GR169257 96 Well

Nori® Monkey S100A13 ELISA Kit

Sign In for Pricing
View Details
IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1
MBS6310030-01 0.1 mL

IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1

Sign In for Pricing
View Details
IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1
MBS6310030-02 5x 0.1 mL

IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Enterotoxin type H (entH)
CSB-YP357926FKZb0-01 20 µg

Recombinant Staphylococcus aureus Enterotoxin type H (entH)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Enterotoxin type H (entH)
CSB-YP357926FKZb0-02 100 µg

Recombinant Staphylococcus aureus Enterotoxin type H (entH)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Enterotoxin type H (entH)
CSB-YP357926FKZb0-03 1 mg

Recombinant Staphylococcus aureus Enterotoxin type H (entH)

Sign In for Pricing
View Details