What is the catalog number for Human DIABLO protein?

The catalog number for Human DIABLO protein is orb605115.

What sizes are available for Human DIABLO protein?

Human DIABLO protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human DIABLO protein come in?

Human DIABLO protein is available in 3 different pack sizes.

Is Human DIABLO protein in stock?

Human DIABLO protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human DIABLO protein

This Human DIABLO protein spans the amino acid sequence from region 56-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Direct IAP-binding protein with low pI (Second mitochondria-derived activator of caspase) (Smac) (SMAC)

UniProt

Q9NR28

Expression Region

56-239aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED