Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DIABLO protein

This Human DIABLO protein spans the amino acid sequence from region 56-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Direct IAP-binding protein with low pI (Second mitochondria-derived activator of caspase) (Smac) (SMAC)

UniProt

Q9NR28

Expression Region

56-239aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLCO4C1 Antibody [FITC]
NBP3-06278F 0.1 mL

Rabbit Polyclonal SLCO4C1 Antibody [FITC]

Sign In for Pricing
View Details
Phospho-SQSTM1/p62 (Ser28) Antibody
AF8601-01 100 µL

Phospho-SQSTM1/p62 (Ser28) Antibody

Sign In for Pricing
View Details
Phospho-SQSTM1/p62 (Ser28) Antibody
AF8601-02 200 µL

Phospho-SQSTM1/p62 (Ser28) Antibody

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgY (H&L) Biotin
L35045 1 mL

Rabbit Anti-Chicken IgY (H&L) Biotin

Sign In for Pricing
View Details
Recombinant Drosophila simulans Serine/threonine-protein phosphatase Pgam5, mitochondrial (Pgam5), partial
MBS1147783-01 0.5 mg (E-Coli)

Recombinant Drosophila simulans Serine/threonine-protein phosphatase Pgam5, mitochondrial (Pgam5), partial

Sign In for Pricing
View Details
Recombinant Drosophila simulans Serine/threonine-protein phosphatase Pgam5, mitochondrial (Pgam5), partial
MBS1147783-02 0.05 mg (Baculovirus)

Recombinant Drosophila simulans Serine/threonine-protein phosphatase Pgam5, mitochondrial (Pgam5), partial

Sign In for Pricing
View Details