Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DIABLO protein

This Human DIABLO protein spans the amino acid sequence from region 56-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Direct IAP-binding protein with low pI (Second mitochondria-derived activator of caspase) (Smac) (SMAC)

UniProt

Q9NR28

Expression Region

56-239aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC17 Adenovirus (Mouse)
15237054 1.0 mL

CCDC17 Adenovirus (Mouse)

Sign In for Pricing
View Details
NAT2 Human qPCR Primer Pair (NM_000015)
HP200002 200 Reactions

NAT2 Human qPCR Primer Pair (NM_000015)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NEK3 Polyclonal Antibody
MBS9005493 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) NEK3 Polyclonal Antibody

Sign In for Pricing
View Details
RDM1 (RAD52 Motif-containing Protein 1, RAD52B)
331877 100 µL

RDM1 (RAD52 Motif-containing Protein 1, RAD52B)

Sign In for Pricing
View Details
Rabbit Anti-OGFOD1 antibody
SL8038R-01 50 µL

Rabbit Anti-OGFOD1 antibody

Sign In for Pricing
View Details
Rabbit Anti-OGFOD1 antibody
SL8038R-02 100 µL

Rabbit Anti-OGFOD1 antibody

Sign In for Pricing
View Details