Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLCO2B1 protein

This Human SLCO2B1 protein spans the amino acid sequence from region 461-564aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2) (OATPRP2) (Solute carrier family 21 member 9) (KIAA0880) (OATP2B1) (OATPB) (SLC21A9)

UniProt

O94956

Expression Region

461-564aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLIN5 Rabbit Polyclonal Antibody (Carrier-free)
orb3103548 100 µg

PLIN5 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Sheep Uracil DNA Glycosylase ELISA Kit
MBS085241-01 48 Well

Sheep Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Sheep Uracil DNA Glycosylase ELISA Kit
MBS085241-02 96 Well

Sheep Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Sheep Uracil DNA Glycosylase ELISA Kit
MBS085241-03 5x 96 Well

Sheep Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
Sheep Uracil DNA Glycosylase ELISA Kit
MBS085241-04 10x 96 Well

Sheep Uracil DNA Glycosylase ELISA Kit

Sign In for Pricing
View Details
TMEM126A Recombinant Protein (Mouse)
RP179261 100 µg

TMEM126A Recombinant Protein (Mouse)

Sign In for Pricing
View Details