Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YJEFN3 protein

This Human YJEFN3 protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YjeF_N3 (hYjeF_N3)

UniProt

A6XGL0

Expression Region

1-299aa

Tag

Tag-Free

Source

Yeast

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcfd2 (NM_139253) Rat Untagged Clone
RN213891 10 µg

Mcfd2 (NM_139253) Rat Untagged Clone

Sign In for Pricing
View Details
SARS Protein Vector (Mouse) (pPM-C-HA)
PV226688 500 ng

SARS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human ZSCAN9 qPCR Primer Pair
QH25281S 200 Tests

Human ZSCAN9 qPCR Primer Pair

Sign In for Pricing
View Details
IGKV2OR22-4 siRNA Oligos set (Human)
24648171 3x 5 nmol

IGKV2OR22-4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
DNAJB9 Rabbit Polyclonal Antibody
orb2953808-01 50 µg

DNAJB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAJB9 Rabbit Polyclonal Antibody
orb2953808-02 100 µg

DNAJB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details