Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor Short name, GIF L-dopachrome isomerase L-dopachrome tautomerase (EC, 5.3.3.12) Phenylpyruvate tautomerase MIF GLIF, MMIF

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NR2C2 Antibody (8J526)
TMAB-09614-01 25 µL

Anti-NR2C2 Antibody (8J526)

Sign In for Pricing
View Details
Anti-NR2C2 Antibody (8J526)
TMAB-09614-02 50 μL

Anti-NR2C2 Antibody (8J526)

Sign In for Pricing
View Details
Anti-NR2C2 Antibody (8J526)
TMAB-09614-03 100 µL

Anti-NR2C2 Antibody (8J526)

Sign In for Pricing
View Details
INPP5A Rabbit Polyclonal Antibody (HRP)
orb2089967 100 µL

INPP5A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
LMOD2, NT (LMOD2, Leiomodin-2, Cardiac leiomodin) (MaxLight 650) discontinued
037837-ML650 100 µL

LMOD2, NT (LMOD2, Leiomodin-2, Cardiac leiomodin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Core 1 O-glycan (C1)
HY-158471 10 µg

Core 1 O-glycan (C1)

Sign In for Pricing
View Details