Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MIF protein

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycosylation-inhibiting factor Short name, GIF L-dopachrome isomerase L-dopachrome tautomerase (EC, 5.3.3.12) Phenylpyruvate tautomerase MIF GLIF, MMIF

UniProt

P14174

Expression Region

2-115aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome p450 1A (CYP1A) (rainbow trout)
C9095-10Y 100 µL

Cytochrome p450 1A (CYP1A) (rainbow trout)

Sign In for Pricing
View Details
Con-Ins F2 Antibody
orb860140 2 mg

Con-Ins F2 Antibody

Sign In for Pricing
View Details
TRIT1 Antibody
orb2682678-01 50 µL

TRIT1 Antibody

Sign In for Pricing
View Details
TRIT1 Antibody
orb2682678-02 100 µL

TRIT1 Antibody

Sign In for Pricing
View Details
TRIT1 Antibody
orb2682678-03 200 µL

TRIT1 Antibody

Sign In for Pricing
View Details
Human Interleukin 11 (IL11) Antibody Pair Kit (with Standard)
MBS2098312-01 5x 96 Tests

Human Interleukin 11 (IL11) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details