Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hamster NEU2 protein

This Hamster NEU2 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic sialidase (N-acetyl-alpha-neuraminidase 2)

UniProt

Q64393

Expression Region

1-379aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF346 protein
orb756350-01 50 µg

Human ZNF346 protein

Sign In for Pricing
View Details
Human ZNF346 protein
orb756350-02 100 µg

Human ZNF346 protein

Sign In for Pricing
View Details
Human ZNF346 protein
orb756350-03 200 µg

Human ZNF346 protein

Sign In for Pricing
View Details
Human ZNF346 protein
orb756350-04 1 mg

Human ZNF346 protein

Sign In for Pricing
View Details
Pcnt sgRNA CRISPR Lentivector set (Mouse)
K3002701 3x 1.0 µg

Pcnt sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Hrasls5 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7489803 1.0 µg DNA

Hrasls5 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details