Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pkdcc protein

This Mouse Pkdcc protein spans the amino acid sequence from region 33-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase domain-containing protein, cytoplasmic (Protein kinase-like protein SgK493) (Sugen kinase 493) (Vertebrate lonesome kinase) (Sgk493) (Vlk)

UniProt

Q5RJI4

Expression Region

33-492aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD3 Rabbit Polyclonal Antibody (HRP)
orb2089484 100 µL

SAMD3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PHPT1 Antibody
MBS2527746-01 0.06 mL

PHPT1 Antibody

Sign In for Pricing
View Details
PHPT1 Antibody
MBS2527746-02 0.12 mL

PHPT1 Antibody

Sign In for Pricing
View Details
PHPT1 Antibody
MBS2527746-03 0.2 mL

PHPT1 Antibody

Sign In for Pricing
View Details
PHPT1 Antibody
MBS2527746-04 5x 0.2 mL

PHPT1 Antibody

Sign In for Pricing
View Details
CD20 Antibody
V7637-100UG 100 µg

CD20 Antibody

Sign In for Pricing
View Details