What is the catalog number for Virus X protein?

The catalog number for Virus X protein is orb605527.

What sizes are available for Virus X protein?

Virus X protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus X protein come in?

Virus X protein is available in 3 different pack sizes.

Is Virus X protein in stock?

Virus X protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus X protein

This Virus X protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBx (Peptide X) (pX)

UniProt

Q9QMI3

Expression Region

1-154aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA