Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus X protein

This Virus X protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HBx (Peptide X) (pX)

UniProt

Q9QMI3

Expression Region

1-154aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)
D9800-11-01 10 L

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)
D9800-11-02 25 L

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)
D9800-11-03 50 L

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)
D9800-11-04 100 L

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)
D9800-11-05 250 L

Dulbecco’s MEM (DMEM) Low Glucose, w/ L-Glutamine, w/o Methionine (Powder)

Sign In for Pricing
View Details
Human Anti Ovary Antibody ELISA Kit
MBS3802307-01 48 Well

Human Anti Ovary Antibody ELISA Kit

Sign In for Pricing
View Details