Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ctsw protein

This Mouse Ctsw protein spans the amino acid sequence from region 126-371aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CtswCathepsin W, EC 3.4.22.-, Lymphopain

UniProt

P56203

Expression Region

126-371aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGVTKYPFTAQVDSPVKKARTSCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3- (4-methoxyphenyl) propanoate
orb1682608-01 1 ml x 10 mM (in DMSO)

Ethyl 3- (4-methoxyphenyl) propanoate

Sign In for Pricing
View Details
Ethyl 3- (4-methoxyphenyl) propanoate
orb1682608-02 100 mg

Ethyl 3- (4-methoxyphenyl) propanoate

Sign In for Pricing
View Details
Ethyl 3- (4-methoxyphenyl) propanoate
orb1682608-03 200 mg

Ethyl 3- (4-methoxyphenyl) propanoate

Sign In for Pricing
View Details
BP-1 (Ly-51, 6C3) (PE) discontinued. see B2628-50C
228030 200 µg

BP-1 (Ly-51, 6C3) (PE) discontinued. see B2628-50C

Sign In for Pricing
View Details
T Plastin Blocking Peptide
MBS9622162-01 1 mg

T Plastin Blocking Peptide

Sign In for Pricing
View Details
T Plastin Blocking Peptide
MBS9622162-02 5x 1 mg

T Plastin Blocking Peptide

Sign In for Pricing
View Details