Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prkaa1 protein

This Mouse Prkaa1 protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetyl-CoA carboxylase kinase (ACACA kinase) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (Tau-protein kinase PRKAA1) (AMPK subunit alpha-1)

UniProt

Q5EG47

Expression Region

1-312aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGA10 Protein (N-His, Human)
P505271 100 µg

ITGA10 Protein (N-His, Human)

Sign In for Pricing
View Details
Simian Troponin T (TNT) ELISA Kit
MBS2707555-01 24 Strip Well

Simian Troponin T (TNT) ELISA Kit

Sign In for Pricing
View Details
Simian Troponin T (TNT) ELISA Kit
MBS2707555-02 48 Strip Well

Simian Troponin T (TNT) ELISA Kit

Sign In for Pricing
View Details
Simian Troponin T (TNT) ELISA Kit
MBS2707555-03 96 Strip Well

Simian Troponin T (TNT) ELISA Kit

Sign In for Pricing
View Details
Simian Troponin T (TNT) ELISA Kit
MBS2707555-04 5x 96 Strip Well

Simian Troponin T (TNT) ELISA Kit

Sign In for Pricing
View Details
Simian Troponin T (TNT) ELISA Kit
MBS2707555-05 10x 96 Strip Well

Simian Troponin T (TNT) ELISA Kit

Sign In for Pricing
View Details