Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cxcr3 protein

This Mouse Cxcr3 protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-inducible protein 10 receptor (IP-10 receptor) (CD_antigen, CD183) (CXC-R3) (CXCR-3) (Cmkar3)

UniProt

O88410

Expression Region

1-52aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRX1 Recombinant Protein (Mouse)
RP164981 100 µg

PRRX1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)
MBS1445480-01 0.02 mg (E-Coli)

Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)
MBS1445480-02 0.1 mg (E-Coli)

Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)
MBS1445480-03 0.02 mg (Yeast)

Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)
MBS1445480-04 0.1 mg (Yeast)

Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)
MBS1445480-05 0.02 mg (Baculovirus)

Recombinant Propionibacterium acnes Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details