Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cxcr3 protein

This Mouse Cxcr3 protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-inducible protein 10 receptor (IP-10 receptor) (CD_antigen, CD183) (CXC-R3) (CXCR-3) (Cmkar3)

UniProt

O88410

Expression Region

1-52aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UFD1 Peptide - middle region (AAP59424)
AAP59424-100UG 100 µg

UFD1 Peptide - middle region (AAP59424)

Sign In for Pricing
View Details
Recombinant Mouse POLR3D Protein, His (Fc)-Avi-tagged
POLR3D-6930M 50 µg

Recombinant Mouse POLR3D Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DYNC1I1 antibody - N-terminal region
MBS3210576-01 0.1 mL

DYNC1I1 antibody - N-terminal region

Sign In for Pricing
View Details
DYNC1I1 antibody - N-terminal region
MBS3210576-02 5x 0.1 mL

DYNC1I1 antibody - N-terminal region

Sign In for Pricing
View Details
TIP30 (HTATIP2) Human Over-expression Lysate
orb1347000 100 µg

TIP30 (HTATIP2) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 18 Antibody (RGE53) [Janelia Fluor 549]
NBP1-97715JF549 0.1 mL

Mouse Monoclonal Cytokeratin 18 Antibody (RGE53) [Janelia Fluor 549]

Sign In for Pricing
View Details