Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus BGLAP protein

This Gallus BGLAP protein spans the amino acid sequence from region 49-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)

UniProt

P02822

Expression Region

49-97aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-2 (phospho Ser70) Antibody
A7025-01 50 μL

Bcl-2 (phospho Ser70) Antibody

Sign In for Pricing
View Details
Bcl-2 (phospho Ser70) Antibody
A7025-02 100 µL

Bcl-2 (phospho Ser70) Antibody

Sign In for Pricing
View Details
Anti-CLEC3B Antibody (R1K30)
RHC16902 100 μg

Anti-CLEC3B Antibody (R1K30)

Sign In for Pricing
View Details
Hepatitis Surface Antigen (HBsAg) (AP)
MBS6126247-01 0.1 mL

Hepatitis Surface Antigen (HBsAg) (AP)

Sign In for Pricing
View Details
Hepatitis Surface Antigen (HBsAg) (AP)
MBS6126247-02 5x 0.1 mL

Hepatitis Surface Antigen (HBsAg) (AP)

Sign In for Pricing
View Details
Zfp280b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50899114 3x 1.0 µg

Zfp280b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details