Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus BGLAP protein

This Gallus BGLAP protein spans the amino acid sequence from region 49-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)

UniProt

P02822

Expression Region

49-97aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HYAQDSGVAGAPPNPLEAQREVCELSPDCDELADQIGFQEAYRRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf20 Rabbit Polyclonal Antibody (BF350)
orb2508973 100 µL

C3orf20 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Lentiviral mouse Kif6 shRNA (UAS) - Lentiviral mouse Kif6 shRNA (UAS, RFP) (100)
GTR15167952 1 Vial

Lentiviral mouse Kif6 shRNA (UAS) - Lentiviral mouse Kif6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Slc6a12 shRNA (UAS) - Lentiviral mouse Slc6a12 shRNA (UAS) plasmid
GTR15229867 1 Vial

Lentiviral mouse Slc6a12 shRNA (UAS) - Lentiviral mouse Slc6a12 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MYF-01-37 2mg
A22556-2 2 mg

MYF-01-37 2mg

Sign In for Pricing
View Details
BIRH 414-d5
162857 2.5 mg

BIRH 414-d5

Sign In for Pricing
View Details
Xanthoxyline
MBS575478 Inquire

Xanthoxyline

Sign In for Pricing
View Details