Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lefty2 protein

This Mouse Lefty2 protein spans the amino acid sequence from region 78-368aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Left-right determination factor B (Protein lefty-2) (Protein lefty-B) (Leftb)

UniProt

P57785

Expression Region

78-368aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP7 Protein Vector (Human) (pPM-N-D-C-His)
PV323037 500 ng

AQP7 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
AP1S1 Antibody (N-Term)
MBS9214996-01 0.08 mL

AP1S1 Antibody (N-Term)

Sign In for Pricing
View Details
AP1S1 Antibody (N-Term)
MBS9214996-02 0.4 mL

AP1S1 Antibody (N-Term)

Sign In for Pricing
View Details
AP1S1 Antibody (N-Term)
MBS9214996-03 5x 0.4 mL

AP1S1 Antibody (N-Term)

Sign In for Pricing
View Details
GLT8D1 siRNA (Mouse)
MBS8203495-01 15 nmol

GLT8D1 siRNA (Mouse)

Sign In for Pricing
View Details
GLT8D1 siRNA (Mouse)
MBS8203495-02 30 nmol

GLT8D1 siRNA (Mouse)

Sign In for Pricing
View Details